Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantVEGF165, Human (HEK293-expressed)

Vascular Endothelial Growth Factor is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates VEGF in the induction of tumor metastasis and intra-ocular neovascular syndromes. VEGF signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the mouse homolog of KDR is the flk-1 gene product) and the flt4 gene product.

Product Specifications

Product Name Alternative

Vascular Endothelial Growth Factor, VPF, Folliculostellate cell-derived growth factor, Glioma-derived endothelial cell mitogen

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

ED50 < 16 ng/ml, measured in a cell proliferation assay using HUVEC cells.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

20~26 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Vascular Endothelial Growth Factor 165 (VEGF-165) remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor 165 (VEGF-165) should be stable up to 1 week at 4°C or up to 2 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQI MRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRC DKPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Three Prime Repair Exonuclease 2
7-03680 25 µg

Recombinant Human Three Prime Repair Exonuclease 2

Sign In for Pricing
View Details
SCFD1 Double Nickase Plasmid (m)
sc-429478-NIC 20 µg

SCFD1 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Menin (MEN1) (NM_130802) Human Tagged Lenti ORF Clone
RC212429L2 10 µg

Menin (MEN1) (NM_130802) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CARD8 Rabbit Polyclonal Antibody (HRP)
orb2105498 100 µL

CARD8 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
5-Hydroxytryptamine Receptor 3B (HTR3B) Mouse ELISA Kit
B1080 96 Tests

5-Hydroxytryptamine Receptor 3B (HTR3B) Mouse ELISA Kit

Sign In for Pricing
View Details
Mueller Hinton II Agar (Culture media in glass tubes/bottles)
470070 6 Bottles x 500 mL

Mueller Hinton II Agar (Culture media in glass tubes/bottles)

Sign In for Pricing
View Details