Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantVEGF-C, Human

Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D) .Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Flt4 ligand, VRP

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 μg/mL.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

16~19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S292 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
39865061 1.0 µg DNA

RN5S292 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Granzyme B ELISA Kit
SEKM-0088-01 48 Tests

Mouse Granzyme B ELISA Kit

Sign In for Pricing
View Details
Mouse Granzyme B ELISA Kit
SEKM-0088-02 96 Tests

Mouse Granzyme B ELISA Kit

Sign In for Pricing
View Details
CRYGN Human Over-expression Lysate
orb1373266 20 µg

CRYGN Human Over-expression Lysate

Sign In for Pricing
View Details
SPAG17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2265105 3x 1.0 µg

SPAG17 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Mouse Monoclonal TMEM119 Antibody (CL8714)
NBP2-76985 0.1 mL

Mouse Monoclonal TMEM119 Antibody (CL8714)

Sign In for Pricing
View Details