Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RecombinantVEGF-C, Human

Vascular endothelial growth factor C (VEGF-C) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis, lymphangiogenesis and endothelial cell growth and survival, and can also affect the permeability of blood vessels. VEGF-C is expressed in various tissues, however it is not produced in peripheral blood lymphocytes. It forms cell surface-associated non-covalent disulfide linked homodimers, and can bind and activate both VEGFR-2 (flk1) and VEGFR-3 (flt4) receptors. The structure and function of VEGF-C is similar to those of vascular endothelial growth factor D (VEGF-D) .Recombinant human VEGF-C produced in HEK293 cells is a polypeptide chain containing 126 amino acids. A fully biologically active molecule, rhVEGF-C has a molecular mass of 16-19 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques at GenScript.

Product Specifications

Product Name Alternative

Flt4 ligand, VRP

Source

HEK 293

Endotoxin

< 0.2 EU/μg, determined by LAL method.

Purity

> 95% as analyzed by SDS-PAGE.

Bioactivity

Measured in a cell proliferation assay using HMVEC human microvascular endothelial cells. The ED50 for this effect is < 0.5 μg/mL.

Form

Lyophilized after extensive dialysis against PBS.

Molecular Weight

16~19 kDa, observed by reducing SDS-PAGE.

Storage Conditions

Lyophilized recombinant Human Vascular Endothelial Growth Factor C remains stable up to 6 months at -80°C from date of receipt. Upon reconstitution, Human Vascular Endothelial Growth Factor C should be stable up to 1 week at 4°C or up to 3 months at -20°C.

Notes

For research use only.

Applications Notes

Reconstituted in ddH2O or PBS at 100 μg/ml.

Preservative

Lyophilized after extensive dialysis against PBS.

AA Sequence

MAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EYA1/4 (Eyes Absent Homolog 1, EYA1, Eyes Absent Homolog 4, EYA4) discontinued
360209-01 50 µL

EYA1/4 (Eyes Absent Homolog 1, EYA1, Eyes Absent Homolog 4, EYA4) discontinued

Sign In for Pricing
View Details
EYA1/4 (Eyes Absent Homolog 1, EYA1, Eyes Absent Homolog 4, EYA4) discontinued
360209-02 100 µL

EYA1/4 (Eyes Absent Homolog 1, EYA1, Eyes Absent Homolog 4, EYA4) discontinued

Sign In for Pricing
View Details
Bovine Transcription factor Maf (MAF) ELISA kit
GTR10442657 96 Well

Bovine Transcription factor Maf (MAF) ELISA kit

Sign In for Pricing
View Details
NIT1 Polyclonal Antibody, APC Conjugated
bs-6077R-APC 100 µL

NIT1 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Guinea Pig BEN domain containing protein 7 (BEND7) ELISA Kit
GTR10364349 96 Well

Guinea Pig BEN domain containing protein 7 (BEND7) ELISA Kit

Sign In for Pricing
View Details
Cuprous Iodide
abx188662-01 25 g

Cuprous Iodide

Sign In for Pricing
View Details