Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mpt64 Protein

This mpt64 Protein spans the amino acid sequence from region 24-228aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen MPT64

UniProt

P9WIN9

Expression Region

24-228aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ROBO2 shRNA (UAS) - Lentiviral human ROBO2 shRNA (UAS, RFP) (100)
GTR15315087 1 Vial

Lentiviral human ROBO2 shRNA (UAS) - Lentiviral human ROBO2 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Human CTGF/CCN2 Protein, N-His
orb2834490-01 20 µg

Recombinant Human CTGF/CCN2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CTGF/CCN2 Protein, N-His
orb2834490-02 50 µg

Recombinant Human CTGF/CCN2 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CTGF/CCN2 Protein, N-His
orb2834490-03 100 µg

Recombinant Human CTGF/CCN2 Protein, N-His

Sign In for Pricing
View Details
APC-Linked Anti-Major Histocompatibility Complex Class I C (MHCC) Polyclonal Antibody
MBS2127063-01 0.2 mL

APC-Linked Anti-Major Histocompatibility Complex Class I C (MHCC) Polyclonal Antibody

Sign In for Pricing
View Details
APC-Linked Anti-Major Histocompatibility Complex Class I C (MHCC) Polyclonal Antibody
MBS2127063-02 5x 0.2 mL

APC-Linked Anti-Major Histocompatibility Complex Class I C (MHCC) Polyclonal Antibody

Sign In for Pricing
View Details