Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TFPI Protein

This Human TFPI Protein spans the amino acid sequence from region 29-280aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Extrinsic pathway inhibitor , EPILipoprotein-associated coagulation inhibitor , LACI

UniProt

P10646

Expression Region

29-280aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD40 Antibody : LE/AF
OASB00444-500UG 0.5 mg

Mouse CD40 Antibody : LE/AF

Sign In for Pricing
View Details
(Glp1) -Apelin-13 50mg
A13215-50 50 mg

(Glp1) -Apelin-13 50mg

Sign In for Pricing
View Details
CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (APC)
367074-01 25 Tests

CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (APC)

Sign In for Pricing
View Details
CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (APC)
367074-02 100 Tests

CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (APC)

Sign In for Pricing
View Details
CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (APC)
367074-03 200 Tests

CD32 (FCGR2A, FCG2, FCGR2A1, IGFR2, Low Affinity Immunoglobulin gamma Fc Region Receptor II-a, CDw32, Fc-gamma RII-a) (APC)

Sign In for Pricing
View Details
Goat G protein coupled receptor 39 (GPR39) ELISA Kit
GTR10364610 96 Well

Goat G protein coupled receptor 39 (GPR39) ELISA Kit

Sign In for Pricing
View Details