Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RHOA Protein

This Human RHOA Protein spans the amino acid sequence from region 1-191aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Rho cDNA clone 12 , h12

UniProt

P61586

Expression Region

1-191aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQARRGKKKSGCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLK8 Antibody, HRP conjugated
MBS7103428-01 0.05 mg

KLK8 Antibody, HRP conjugated

Sign In for Pricing
View Details
KLK8 Antibody, HRP conjugated
MBS7103428-02 0.1 mg

KLK8 Antibody, HRP conjugated

Sign In for Pricing
View Details
KLK8 Antibody, HRP conjugated
MBS7103428-03 5x 0.1 mg

KLK8 Antibody, HRP conjugated

Sign In for Pricing
View Details
Human Tyrosine-protein Kinase Blk, BLK ELISA KIT
E7135Hu-01 48 Well

Human Tyrosine-protein Kinase Blk, BLK ELISA KIT

Sign In for Pricing
View Details
Human Tyrosine-protein Kinase Blk, BLK ELISA KIT
E7135Hu-02 96 Well

Human Tyrosine-protein Kinase Blk, BLK ELISA KIT

Sign In for Pricing
View Details
Human Tyrosine-protein Kinase Blk, BLK ELISA KIT
E7135Hu-03 5x 96 Tests

Human Tyrosine-protein Kinase Blk, BLK ELISA KIT

Sign In for Pricing
View Details