Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PFDN5 Protein

This Human PFDN5 Protein spans the amino acid sequence from region 2-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-Myc-binding protein Mm-1Myc modulator 1

UniProt

Q99471

Expression Region

2-154aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

8-Bromo-cAMP Sodium Salt
TRC-B693278-50MG 50 mg

8-Bromo-cAMP Sodium Salt

Sign In for Pricing
View Details
Single Frequency type Ultrasonic Cleaner BULC-718
BULC-718 Each

Single Frequency type Ultrasonic Cleaner BULC-718

Sign In for Pricing
View Details
Human SNAP25 activation kit by CRISPRa
GA104529 1 Kit

Human SNAP25 activation kit by CRISPRa

Sign In for Pricing
View Details
CCDC85A (NM_001080433) Human Recombinant Protein
TP314649 20 µg

CCDC85A (NM_001080433) Human Recombinant Protein

Sign In for Pricing
View Details
HDAC5 Human Gene Knockout Kit (CRISPR)
KN208656 1 Kit

HDAC5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human CXCL9 Recombinant Rabbit monoclonal Antibody
HA725004 100 µL

Human CXCL9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details