Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PFDN5 Protein

This Human PFDN5 Protein spans the amino acid sequence from region 2-154aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-Myc-binding protein Mm-1Myc modulator 1

UniProt

Q99471

Expression Region

2-154aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (acetyl K382) Antibody
KC-4094-01 50 μL

P53 (acetyl K382) Antibody

Sign In for Pricing
View Details
P53 (acetyl K382) Antibody
KC-4094-02 100 µL

P53 (acetyl K382) Antibody

Sign In for Pricing
View Details
P53 (acetyl K382) Antibody
KC-4094-03 1 mL

P53 (acetyl K382) Antibody

Sign In for Pricing
View Details
P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL
BNC680984-100 1x 100 µL

P21 / WAF1 (HJ21), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor Antibody
KC-26324-01 50 μL

Von Willebrand Factor Antibody

Sign In for Pricing
View Details
Von Willebrand Factor Antibody
KC-26324-02 100 µL

Von Willebrand Factor Antibody

Sign In for Pricing
View Details