Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMI1 Protein

This Human BMI1 Protein spans the amino acid sequence from region 1-250aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Polycomb group RING finger protein 4RING finger protein 51

UniProt

P35226

Expression Region

1-250aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bellissaponin BS1
T126211-01 1 mg

Bellissaponin BS1

Sign In for Pricing
View Details
Bellissaponin BS1
T126211-02 5 mg

Bellissaponin BS1

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit
MBS2159802-01 96 Tests

Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit
MBS2159802-02 5x 96 Tests

Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit
MBS2159802-03 10x 96 Tests

Solute Carrier Family 16, Member 1 (SLC16A1) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
AL 8697
T10277-01 500 mg

AL 8697

Sign In for Pricing
View Details