Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GABARAPL2 Protein

This Human GABARAPL2 Protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

GABA (A) receptor-associated protein-like 2Ganglioside expression factor 2 , GEF-2General protein transport factor p16Golgi-associated ATPase enhancer of 16KDA , GATE-16MAP1 light chain 3-related protein

UniProt

P60520

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR52E6 shRNA Plasmid
abx967933-01 150 µg

Human OR52E6 shRNA Plasmid

Sign In for Pricing
View Details
Human OR52E6 shRNA Plasmid
abx967933-02 300 µg

Human OR52E6 shRNA Plasmid

Sign In for Pricing
View Details
TIS11D (ZFP36L2) (NM_006887) Human Tagged Lenti ORF Clone
RC216401L3 10 µg

TIS11D (ZFP36L2) (NM_006887) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral human TMEM269 sgRNA gene knockout kit - Lentiviral human TMEM269 sgRNA gene knockout kit (25)
GTR15375534 1 Vial

Lentiviral human TMEM269 sgRNA gene knockout kit - Lentiviral human TMEM269 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Mouse Monoclonal Alkaline Phosphatase/ALPL Antibody (B4-78) [Allophycocyanin/Cy7]
FAB1448APCCY7 0.1 mL

Mouse Monoclonal Alkaline Phosphatase/ALPL Antibody (B4-78) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
Mouse Polyclonal IFN-alpha K Antibody
H00056832-B01P 0.05 mg

Mouse Polyclonal IFN-alpha K Antibody

Sign In for Pricing
View Details