Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COMMD4 Protein

This Human COMMD4 Protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COMD4_HUMAN, COMM domain containing 4, COMM domain-containing protein 4, COMMD4

UniProt

Q9H0A8

Expression Region

1-195aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRFRFCGDLDCPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVAVLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLRVCSLRMNRLAGVGWRVDYTLSSSLLQSVEEPMVHLRLEVAAAPGTPAQPVAMSLSADKFQVLLAELKQAQTLM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (MaxLight 490)
MBS6199877-01 0.1 mL

Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (MaxLight 490)

Sign In for Pricing
View Details
Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (MaxLight 490)
MBS6199877-02 5x 0.1 mL

Calreticulin (CRP55, Calregulin, Endoplasmic Reticulum Resident Protein 60, ERp60, HACBP, grp60, CRTC, CALR) (MaxLight 490)

Sign In for Pricing
View Details
Kallikrein 8 (15B19) Rabbit Monoclonal Antibody
E28M6768 100 µL

Kallikrein 8 (15B19) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MS4A7 Lentiviral Activation Particles (h)
sc-412906-LAC 200 µL

MS4A7 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
FGFR4 (7H1) Antibody
252869 0.1 mL

FGFR4 (7H1) Antibody

Sign In for Pricing
View Details
LSZH-187-2-YL-4 Pre-sized Sleeves for Printers
141230 10000 Roll (10000 Sleeve (s) x 1 Roll)

LSZH-187-2-YL-4 Pre-sized Sleeves for Printers

Sign In for Pricing
View Details