Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human VEGFC Protein

This Human VEGFC Protein spans the amino acid sequence from region 112-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Flt4 ligand , Flt4-LVascular endothelial growth factor-related protein , VRP

UniProt

P49767

Expression Region

112-227aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD2/CD2 Antibody Picoband® Fluoro488 Conjugated
PA1743-Fluoro488 100 µg/Vial

Anti-CD2/CD2 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
CNDP2 Protein (N-His, Human)
P502688 100 µg

CNDP2 Protein (N-His, Human)

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-01 48 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-02 96 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-03 5x 96 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details
Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit
MBS280153-04 10x 96 Tests

Sheep V-type proton ATPase 16 kDa proteolipid subunit (ATP6V0C) ELISA Kit

Sign In for Pricing
View Details