What is the catalog number for Human Complement C3 Protein?

The catalog number for Human Complement C3 Protein is orb1478159.

What sizes are available for Human Complement C3 Protein?

Human Complement C3 Protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human Complement C3 Protein come in?

Human Complement C3 Protein is available in 3 different pack sizes.

Is Human Complement C3 Protein in stock?

Human Complement C3 Protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human Complement C3 Protein

This Human Complement C3 Protein spans the amino acid sequence from region 26-225aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ASP, C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1, C3, C3adesArg, C3bc, CO3_HUMAN, Complement C3c alpha'' chain fragment 2

UniProt

P01024

Expression Region

26-225aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVMVNIENPEGIPVKQDSLSSQNQLGVLPLSWDIPELVNMGQWKIRAYYENSPQQVFSTEFEVK