Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP6 Protein

This Human BMP6 Protein spans the amino acid sequence from region 382-513aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VG-1-related protein , VG-1-R , VGR-1

UniProt

P22004

Expression Region

382-513aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSE (Enolase2, gamma-Enolase, body, Enolase2, Neuron Specific Enolase, Enolase 2 gamma Neuronal, Neural Enolase, NSE, Neuron Specific gamma Enolase) (HRP)
MBS6262616-01 0.1 mL

NSE (Enolase2, gamma-Enolase, body, Enolase2, Neuron Specific Enolase, Enolase 2 gamma Neuronal, Neural Enolase, NSE, Neuron Specific gamma Enolase) (HRP)

Sign In for Pricing
View Details
NSE (Enolase2, gamma-Enolase, body, Enolase2, Neuron Specific Enolase, Enolase 2 gamma Neuronal, Neural Enolase, NSE, Neuron Specific gamma Enolase) (HRP)
MBS6262616-02 5x 0.1 mL

NSE (Enolase2, gamma-Enolase, body, Enolase2, Neuron Specific Enolase, Enolase 2 gamma Neuronal, Neural Enolase, NSE, Neuron Specific gamma Enolase) (HRP)

Sign In for Pricing
View Details
Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2) (MaxLight 550)
143632-ML550 100 µL

Interleukin 6 (IL6, Interleukin-6, IL-6, B Cell Stimulatory Factor 2, BSF-2, CTL Differentiation Factor, CDF, Hybridoma Growth Factor, Interferon beta-2, IFN-beta-2, IFNB2) (MaxLight 550)

Sign In for Pricing
View Details
ARX (Homeobox Protein ARX, Aristaless-related Homeobox, CT121, EIEE1, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (Biotin)
123587-Biotin 100 µL

ARX (Homeobox Protein ARX, Aristaless-related Homeobox, CT121, EIEE1, MRX29, MRX32, MRX33, MRX36, MRX38, MRX43, MRX54, MRX76, MRX87, MRXS1, PRTS) (Biotin)

Sign In for Pricing
View Details
Rabbit Anti SRP19 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence)
IRBAMLSRP19AP340120UL 1 Each

Rabbit Anti SRP19 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot,IHC,Immunofluorescence)

Sign In for Pricing
View Details
APOL1, CT (Apolipoprotein L1, Apolipoprotein L-I, ApoL-I, Apolipoprotein L, Apo-L, ApoL) (AP) discontinued
A2299-11F-AP 200 µL

APOL1, CT (Apolipoprotein L1, Apolipoprotein L-I, ApoL-I, Apolipoprotein L, Apo-L, ApoL) (AP) discontinued

Sign In for Pricing
View Details