Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BMP6 Protein

This Human BMP6 Protein spans the amino acid sequence from region 382-513aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

VG-1-related protein , VG-1-R , VGR-1

UniProt

P22004

Expression Region

382-513aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELYVSFQDLGWQDWIIAPKGYAANYCDGECSFPLNAHMNATNHAIVQTLVHLMNPEYVPKPCCAPTKLNAISVLYFDDNSNVILKKYRNMVVRACGCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ESD Antibody Picoband® Fluoro550 Conjugated
A01471-1-Fluoro550 100 µg/Vial

Anti-ESD Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Human OR4D11 Knockout HEK293T cell line
GTR15402223 1 Vial

Human OR4D11 Knockout HEK293T cell line

Sign In for Pricing
View Details
Bovine Desmogleins 1 (DSG-E1) ELISA Kit
MBS2611643-01 48 Well

Bovine Desmogleins 1 (DSG-E1) ELISA Kit

Sign In for Pricing
View Details
Bovine Desmogleins 1 (DSG-E1) ELISA Kit
MBS2611643-02 96 Well

Bovine Desmogleins 1 (DSG-E1) ELISA Kit

Sign In for Pricing
View Details
Bovine Desmogleins 1 (DSG-E1) ELISA Kit
MBS2611643-03 5x 96 Well

Bovine Desmogleins 1 (DSG-E1) ELISA Kit

Sign In for Pricing
View Details
Bovine Desmogleins 1 (DSG-E1) ELISA Kit
MBS2611643-04 10x 96 Well

Bovine Desmogleins 1 (DSG-E1) ELISA Kit

Sign In for Pricing
View Details