Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KNG1 Protein

This Human KNG1 Protein spans the amino acid sequence from region 390-639aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Alpha-2-thiol proteinase inhibitorFitzgerald factorHigh molecular weight kininogen , HMWKWilliams-Fitzgerald-Flaujeac factor

UniProt

P01042

Expression Region

390-639aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SSRIGEIKEETTVSPPHTSMAPAQDEERDSGKEQGHTRRHDWGHEKQRKHNLGHGHKHERDQGHGHQRGHGLGHGHEQQHGLGHGHKFKLDDDLEHQGGHVLDHGHKHKHGHGHGKHKNKGKKNGKHNGWKTEHLASSSEDSTTPSAQTQEKTEGPTPIPSLAKPGVTVTFSDFQDSDLIATMMPPISPAPIQSDDDWIPDIQIDPNGLSFNPISDFPDTTSPKCPGRPWKSVSEINPTTQMKESYYFDL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF829 Protein Lysate (Human) with C-Ha Tag
51868031 100 µg

ZNF829 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
MEK-2 (Phospho-Thr394) Antibody
E011008-2 100 µg -100 µL

MEK-2 (Phospho-Thr394) Antibody

Sign In for Pricing
View Details
Lentiviral human NEPRO shRNA (UAS) - Lentiviral human NEPRO shRNA (UAS, iRFP) (100)
GTR15119727 1 Vial

Lentiviral human NEPRO shRNA (UAS) - Lentiviral human NEPRO shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Anti-Relaxin (RLN) Polyclonal antibody
FY-AB36536-01 1 mL

Anti-Relaxin (RLN) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Relaxin (RLN) Polyclonal antibody
FY-AB36536-02 100 µL

Anti-Relaxin (RLN) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Relaxin (RLN) Polyclonal antibody
FY-AB36536-03 200 µL

Anti-Relaxin (RLN) Polyclonal antibody

Sign In for Pricing
View Details