Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Avpr1b Protein

This Rat Avpr1b Protein spans the amino acid sequence from region 343-425aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AVPR V1bAVPR V3Antidiuretic hormone receptor 1bVasopressin V3 receptor

UniProt

P48974

Expression Region

343-425aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Epigenetics, GPCR, Neuroscience, Signaling Pathways

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

13 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NSRLLPRSLSHHACCTGSKPQVHRQLSTSSLTSRRTTLLTHACGSPTLRLSLNLSLRAKPRPAGSLKDLEQVDGEATMETSIF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Moisture Analyzer BANA-506
BANA-506 1 Unit

Moisture Analyzer BANA-506

Sign In for Pricing
View Details
CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), 0.2mg/mL
BNUB1700-500 1x 500 µL

CD44v4 (Marker of Tumor Metastasis) (CD44v4/1700R), 0.2mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS800328 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
Tenacissoside H
TRC-T018000-250MG 250 mg

Tenacissoside H

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF594 conjugate, 0.1mg/mL
BNC942197-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
rel-1-(1R,2S,4R)-Bicyclo[2.2.1]hept-5-en-2-yl-3-(1-piperidinyl)-1-propanone
TRC-B148210-50MG 50 mg

rel-1-(1R,2S,4R)-Bicyclo[2.2.1]hept-5-en-2-yl-3-(1-piperidinyl)-1-propanone

Sign In for Pricing
View Details