Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ngf Protein

This Rat Ngf Protein spans the amino acid sequence from region 124-241aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ngf, Ngfb, Beta-nerve growth factor, Beta-NGF

UniProt

P25427

Expression Region

124-241aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGHA1, CT (Ig alpha-1 Chain C Region, Immunoglobulin Heavy Constant alpha 1, IgA1) (Biotin) discontinued
I1904-93-Biotin 200 µL

IGHA1, CT (Ig alpha-1 Chain C Region, Immunoglobulin Heavy Constant alpha 1, IgA1) (Biotin) discontinued

Sign In for Pricing
View Details
Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit
CK-bio-20139-01 48 Tests

Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit

Sign In for Pricing
View Details
Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit
CK-bio-20139-02 96 Tests

Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit

Sign In for Pricing
View Details
Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit
CK-bio-20139-03 5x 96 Tests

Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit

Sign In for Pricing
View Details
Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit
CK-bio-20139-04 10x 96 Tests

Mouse Methylcytosine dioxygenase TET2 (TET2) ELISA kit

Sign In for Pricing
View Details
Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (FITC) discontinued
302417-FITC 200 µL

Epcam (Epithelial Cell Adhesion Molecule, Ep-CAM, Epithelial GlycoProtein 314, EGP314, mEGP314, Protein 289A, Tumor-Associated Calcium signal Transducer 1, CD326, Epcam, Tacstd1) (FITC) discontinued

Sign In for Pricing
View Details