Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Ngf Protein

This Rat Ngf Protein spans the amino acid sequence from region 124-241aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ngf, Ngfb, Beta-nerve growth factor, Beta-NGF

UniProt

P25427

Expression Region

124-241aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Neuroscience

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPECIALfinder DigIT Mustard (mustard) Assay Acc. to DIN CEN|TS 15634-5 Assay
DAV14K-CEN 1 Each

SPECIALfinder DigIT Mustard (mustard) Assay Acc. to DIN CEN|TS 15634-5 Assay

Sign In for Pricing
View Details
Phospho-NFKB1 (Ser893) Antibody Blocking Peptide
orb1503542 500 µg

Phospho-NFKB1 (Ser893) Antibody Blocking Peptide

Sign In for Pricing
View Details
SPINT2 Protein (C-His, Mouse)
P528731 100 µg

SPINT2 Protein (C-His, Mouse)

Sign In for Pricing
View Details
PEGFP-flag-KIR2DL2
PPL00346-2a 1 Each

PEGFP-flag-KIR2DL2

Sign In for Pricing
View Details
Recombinant Human ANGPTL3 Protein, C-His
EHJ88801 100 μg

Recombinant Human ANGPTL3 Protein, C-His

Sign In for Pricing
View Details
DGUOK Rabbit Polyclonal Antibody (HRP)
orb2092520 100 µL

DGUOK Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details