Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CASP8 Protein

This Human CASP8 Protein spans the amino acid sequence from region 217-374aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Apoptotic cysteine protease Apoptotic protease Mch-5 CAP4 FADD-homologous ICE/ced-3-like protease FADD-like ICE Short name, FLICE ICE-like apoptotic protease 5 MORT1-associated ced-3 homolog Short name, MACH Cleaved into the following 2 chains, Caspase-8 subunit p18 Caspase-8 subunit p10

UniProt

Q14790

Expression Region

217-374aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse monoclonal antibody to HPV-18 E2, clone 2E7
A2-401-100-01 100 µg

Mouse monoclonal antibody to HPV-18 E2, clone 2E7

Sign In for Pricing
View Details
Mouse monoclonal antibody to HPV-18 E2, clone 2E7
A2-401-100-02 500 µg

Mouse monoclonal antibody to HPV-18 E2, clone 2E7

Sign In for Pricing
View Details
Mouse monoclonal antibody to HPV-18 E2, clone 2E7
A2-401-100-03 1 mg

Mouse monoclonal antibody to HPV-18 E2, clone 2E7

Sign In for Pricing
View Details
Lmo4 Mouse qPCR Primer Pair (NM_010723)
MP207522 200 Reactions

Lmo4 Mouse qPCR Primer Pair (NM_010723)

Sign In for Pricing
View Details
Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) TRMFO Polyclonal Antibody
MBS7193364 Inquire

Rabbit anti-Synechococcus elongatus (strain PCC 7942)(Anacystis nidulans R2) TRMFO Polyclonal Antibody

Sign In for Pricing
View Details
Human IRAK Recombinant Protein C-terminal His Tag
MBS8432558-01 0.05 mg

Human IRAK Recombinant Protein C-terminal His Tag

Sign In for Pricing
View Details