Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY6G6D Protein

This Human LY6G6D Protein spans the amino acid sequence from region 10-104aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LY66D_HUMAN, Ly6g6d, Lymphocyte antigen 6 complex locus protein G6d, Megakaryocyte-enhanced gene transcript 1 protein, Protein Ly6-D

UniProt

O95868

Expression Region

10-104aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Placental protein 14 (human, PP14, glycodelin A)
BTE 001-16-1 1 mL

Anti-Placental protein 14 (human, PP14, glycodelin A)

Sign In for Pricing
View Details
4- (Dimethylamino) -2- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) butanoic acid hydrochloride
MKD48899-01 50 mg

4- (Dimethylamino) -2- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) butanoic acid hydrochloride

Sign In for Pricing
View Details
4- (Dimethylamino) -2- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) butanoic acid hydrochloride
MKD48899-02 0.5 g

4- (Dimethylamino) -2- ({[ (9H-fluoren-9-yl) methoxy]carbonyl}amino) butanoic acid hydrochloride

Sign In for Pricing
View Details
SLPI (Secretory Leukocyte Protease Inhibitor) Guinea Pig ELISA Kit
H1134 96 Tests

SLPI (Secretory Leukocyte Protease Inhibitor) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
KLF13 ORF Vector (Human) (pORF)
25743011 1.0 µg DNA

KLF13 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Glycoprotein/G2, RVFV (sf9, His)
HY-P76577 1 Each

Glycoprotein/G2, RVFV (sf9, His)

Sign In for Pricing
View Details