Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lithobates catesbeiana Saxiphilin Protein

This Lithobates catesbeiana Saxiphilin Protein spans the amino acid sequence from region 484-844aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SAX

UniProt

P31226

Expression Region

484-844aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

American bullfrog

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHLPSKNKVRWCTINKLEKMKCDDWSAVSGGAIACTEASCPKGCVKQILKGEADAVKLEVQYMYEALMCGLLPAVEEYHNKDDFGPCKTPGSPYTDFGTLRAVALVKKSNKDINWNNIKGKKSCHTGVGDIAGWVIPVSLIRRQNDNSDIDSFFGESCAPGSDTKSNLCKLCIGDPKNSAANTKCSLSDKEAYYGNQGAFRCLVEKGDVAFVPHTVVFENTDGKNPAVWAKNLKSEDFELLCLDGSRAPVSNYKSCKLSGIPPPAIVTREESISDVVRIVANQQSLYGRKGFEKDMFQLFSSNKGNNLLFNDNTQCLITFDRQPKDIMEDYFGKPYYTTVYGASRSAMSSELISACTIKHC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Glutathione Peroxidase 1 (GPX1) ELISA Kit
DL-GPX1-Ra-01 48 Tests

Rat Glutathione Peroxidase 1 (GPX1) ELISA Kit

Sign In for Pricing
View Details
Rat Glutathione Peroxidase 1 (GPX1) ELISA Kit
DL-GPX1-Ra-02 96 Tests

Rat Glutathione Peroxidase 1 (GPX1) ELISA Kit

Sign In for Pricing
View Details
YM155
2310-25 25 mg

YM155

Sign In for Pricing
View Details
Rabbit Polyclonal CACNB3 Antibody [DyLight 594]
NBP2-99461DL594 0.1 mL

Rabbit Polyclonal CACNB3 Antibody [DyLight 594]

Sign In for Pricing
View Details
DEFB108P3 sgRNA CRISPR Lentivector (Human) (Target 2)
K0579303 1.0 µg DNA

DEFB108P3 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Rabbit anti-ZNF600 Antibody
YLD8332-01 50 µL

Rabbit anti-ZNF600 Antibody

Sign In for Pricing
View Details