Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mpt64 Protein

This mpt64 Protein spans the amino acid sequence from region 24-228aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Antigen MPT64

UniProt

P9WIN9

Expression Region

24-228aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

24.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APKTYCEELKGTDTGQACQIQMSDPAYNINISLPSYYPDQKSLENYIAQTRDKFLSAATSSTPREAPYELNITSATYQSAIPPRGTQAVVLKVYQNAGGTHPTTTYKAFDWDQAYRKPITYDTLWQADTDPLPVVFPIVQGELSKQTGQQVSIAPNAGLDPVNYQNFAVTNDGVIFFFNPGELLPEAAGPTQVLVPRSAIDSMLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Wfdc5 qPCR Primer Pair
QM54026S 200 Tests

Mouse Wfdc5 qPCR Primer Pair

Sign In for Pricing
View Details
PCDHAC1 Rabbit pAb, IRDye 800CW conjugated
orb2825124 100 µL

PCDHAC1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
POLR3C Protein Vector (Rat) (pPB-N-His)
PV295175 500 ng

POLR3C Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Recombinant Oenococcus oeni ATP synthase gamma chain (atpG)
MBS1377356-01 0.02 mg (E-Coli)

Recombinant Oenococcus oeni ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Oenococcus oeni ATP synthase gamma chain (atpG)
MBS1377356-02 0.02 mg (Yeast)

Recombinant Oenococcus oeni ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details
Recombinant Oenococcus oeni ATP synthase gamma chain (atpG)
MBS1377356-03 0.1 mg (E-Coli)

Recombinant Oenococcus oeni ATP synthase gamma chain (atpG)

Sign In for Pricing
View Details