Human CLDN6-VLPs Protein

1Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 1.334-1.504 ng/mL. The VLPs is negative control. 2Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody. The EC50 is 2.920-3.812 ng/mL. The VLPs is negative control. 3Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6/9 recombinant antibody. The EC50 is 3.482-4.097 ng/mL. The VLPs is negative control. 4Measured by its binding ability in a functional ELISA. Immobilized Human CLDN6 at 2 μg/mL can bind Anti-CLDN6 recombinant antibody. The EC50 is 2.866-3.739 ng/mL. The VLPs is negative control.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing.

MASAGMQILGVVLTLLGWVNGLVSCALPMWKVTAFIGNSIVVAQVVWEGLWMSCVVQSTGQMQCKVYDSLLALPQDLQAARALCVIALLVALFGLLVYLAGAKCTTCVEEKDSKARLVLTSGIVFVISGVLTLIPVCWTAHAIIRDFYNPLVAEAQKRELGASLYLGWAASGLLLLGGGLLCCTCPSGGSQGPSHYMARYSTSAPAISRGPSEYPTKNYV