Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NOS2 Protein

This Human NOS2 Protein spans the amino acid sequence from region 1-200aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Hepatocyte NOS) (HEP-NOS) (Inducible NO synthase) (Inducible NOS) (iNOS) (NOS type II) (Peptidyl-cysteine S-nitrosylase NOS2)

UniProt

P35228

Expression Region

1-200aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-PRPF6 Antibody Picoband®
A06724-2 100 µg/Vial

Anti-PRPF6 Antibody Picoband®

Sign In for Pricing
View Details
KOUDZACHTWATER100X33RL-T3-P16 Pipe Markers for Water
N006120 220 Roll (220 Marker (s) x 1 Roll)

KOUDZACHTWATER100X33RL-T3-P16 Pipe Markers for Water

Sign In for Pricing
View Details
Protein dispatched homolog 2 (DISP2) Mouse ELISA Kit
G2666 96 Tests

Protein dispatched homolog 2 (DISP2) Mouse ELISA Kit

Sign In for Pricing
View Details
Hinokitiol
AB2916 20 mg

Hinokitiol

Sign In for Pricing
View Details
TOMM20 Antibody
orb2809317 100 µL

TOMM20 Antibody

Sign In for Pricing
View Details
RGD1565611 (NM_001110155) Rat Tagged ORF Clone
RR213129 10 µg

RGD1565611 (NM_001110155) Rat Tagged ORF Clone

Sign In for Pricing
View Details