Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FCER2 Protein

This Human FCER2 Protein spans the amino acid sequence from region 48-248aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23)

UniProt

P06734

Expression Region

48-248aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Leptin (LEP) ELISA Kit
RD-LEP-c-01 96 Tests

Canine Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details
Canine Leptin (LEP) ELISA Kit
RD-LEP-c-02 48 Tests

Canine Leptin (LEP) ELISA Kit

Sign In for Pricing
View Details
ZNF500 Human siRNA Oligo Duplex (Locus ID 26048)
SR308686 1 Kit

ZNF500 Human siRNA Oligo Duplex (Locus ID 26048)

Sign In for Pricing
View Details
1-Bromopentadecane-15,15,15-d3
B686157 10 mg

1-Bromopentadecane-15,15,15-d3

Sign In for Pricing
View Details
NRDE2 Human shRNA Plasmid Kit (Locus ID 55051)
TL306214 1 Kit

NRDE2 Human shRNA Plasmid Kit (Locus ID 55051)

Sign In for Pricing
View Details
Atp6v0d2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7323204 1.0 µg DNA

Atp6v0d2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details