Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1B Protein

This Human IL1B Protein spans the amino acid sequence from region 117-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-1 beta) (Catabolin)

UniProt

P01584

Expression Region

117-269aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Tissue inhibitor of metalloproteinases 4 (30-224) protein (C-6His)
CD00816-01 10 µg

Recombinant Human Tissue inhibitor of metalloproteinases 4 (30-224) protein (C-6His)

Sign In for Pricing
View Details
Recombinant Human Tissue inhibitor of metalloproteinases 4 (30-224) protein (C-6His)
CD00816-02 50 µg

Recombinant Human Tissue inhibitor of metalloproteinases 4 (30-224) protein (C-6His)

Sign In for Pricing
View Details
Human BRD2 Recombinant Protein
PROTP25440-100ug 100 µg

Human BRD2 Recombinant Protein

Sign In for Pricing
View Details
Mouse Peptidase Inhibitor 16 (PI16) ELISA Kit
EK20247 48 Tests

Mouse Peptidase Inhibitor 16 (PI16) ELISA Kit

Sign In for Pricing
View Details
SPRR2D Adenovirus (Mouse)
45389054 1.0 mL

SPRR2D Adenovirus (Mouse)

Sign In for Pricing
View Details
GCET2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2399986 100 µL

GCET2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details