Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IL1B Protein

This Human IL1B Protein spans the amino acid sequence from region 117-269aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(IL-1 beta) (Catabolin)

UniProt

P01584

Expression Region

117-269aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIAA1109 Protein Vector (Human) (pPB-C-His)
PV088910 500 ng

KIAA1109 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Anti-5HT2A Receptor Polyclonal Antibody 4
TMAB-02103-01 50 μL

Anti-5HT2A Receptor Polyclonal Antibody 4

Sign In for Pricing
View Details
Anti-5HT2A Receptor Polyclonal Antibody 4
TMAB-02103-02 100 µL

Anti-5HT2A Receptor Polyclonal Antibody 4

Sign In for Pricing
View Details
Anti-5HT2A Receptor Polyclonal Antibody 4
TMAB-02103-03 200 µL

Anti-5HT2A Receptor Polyclonal Antibody 4

Sign In for Pricing
View Details
Recombinant Human ANC2 (His)
BP4369-50ug 50 µg

Recombinant Human ANC2 (His)

Sign In for Pricing
View Details
4-Methylguaiacol Rutinoside-d3
CS-T-103005 1 Each

4-Methylguaiacol Rutinoside-d3

Sign In for Pricing
View Details