Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Trypsin-2 Protein

This Human Trypsin-2 Protein spans the amino acid sequence from region 16-247aa (K23Q, S167G) . Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Anionic trypsinogen) (Serine protease 2) (Trypsin II)

UniProt

P07478

Expression Region

16-247aa (K23Q, S167G)

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APFDDDDQIVGGYICEENSVPYQVSLNSGYHFCGGSLISEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPKYNSRTLDNDILLIKLSSPAVINSRVSAISLPTAPPAAGTESLISGWGNTLSSGADYPDELQCLDAPVLGQAECEASYPGKITNNMFCVGFLEGGKDSCQGDSGGPVVSNGELQGIVSWGYGCAQKNRPGVYTKVYNYVDWIKDTIAANS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat IGFBP6/IBP6 Protein (His Tag)
PKSR030133 100 µg

Recombinant Rat IGFBP6/IBP6 Protein (His Tag)

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF647 conjugate, 0.1mg/mL
BNC470955-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/955), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
VC1kb DNA Ladder (ready-to-use), 5 x 50µg
NL1412 5 x 50μg

VC1kb DNA Ladder (ready-to-use), 5 x 50µg

Sign In for Pricing
View Details
CD169 Polyclonal Antibody
E-AB-70160-01 60 µL

CD169 Polyclonal Antibody

Sign In for Pricing
View Details
CD169 Polyclonal Antibody
E-AB-70160-02 120 µL

CD169 Polyclonal Antibody

Sign In for Pricing
View Details
CD169 Polyclonal Antibody
E-AB-70160-03 200 µL

CD169 Polyclonal Antibody

Sign In for Pricing
View Details