Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mbl2 Protein

This Mouse Mbl2 Protein spans the amino acid sequence from region 19-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Mannose-binding protein C)

UniProt

Q3UEK1

Expression Region

19-244aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Abscessus frr Protein (aa 1-185)
VAng-Yyj5421-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Abscessus frr Protein (aa 1-185)

Sign In for Pricing
View Details
SPOPL Protein Vector (Rat) (pPM-C-HA)
PV307856 500 ng

SPOPL Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
NCOA4 Rabbit Polyclonal Antibody (Carrier-free)
orb3105857 100 µg

NCOA4 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
SLC6A8 Blocking Peptide
MBS9624680-01 1 mg

SLC6A8 Blocking Peptide

Sign In for Pricing
View Details
SLC6A8 Blocking Peptide
MBS9624680-02 5x 1 mg

SLC6A8 Blocking Peptide

Sign In for Pricing
View Details
CD44v7 Rabbit Polyclonal Antibody (PE-Cy7)
orb969483 100 µL

CD44v7 Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details