Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Mbl2 Protein

This Mouse Mbl2 Protein spans the amino acid sequence from region 19-244aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Mannose-binding protein C)

UniProt

Q3UEK1

Expression Region

19-244aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ETLTEGVQNSCPVVTCSSPGLNGFPGKDGRDGAKGEKGEPGQGLRGLQGPPGKVGPTGPPGNPGLKGAVGPKGDRGDRAEFDTSEIDSEIAALRSELRALRNWVLFSLSEKVGKKYFVSSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIAYLGITDVRVEGSFEDLTGNRVRYTNWNDGEPNNTGDGEDCVVILGNGKWNDVPCSDSFLAICEFSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hippuric Acid Sodium Salt 99% Extrapure
01358 00025 25 g

Hippuric Acid Sodium Salt 99% Extrapure

Sign In for Pricing
View Details
Recombinant Caenorhabditis Elegans T28D9.11 Protein (aa 1-61)
VAng-Ly3832-1mgEcoli 1 mg (E. coli)

Recombinant Caenorhabditis Elegans T28D9.11 Protein (aa 1-61)

Sign In for Pricing
View Details
GPR161 Adenovirus (Mouse)
22526054 1.0 mL

GPR161 Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant DNAJC15 Rabbit mAb
E38MA4210 100 µL

Recombinant DNAJC15 Rabbit mAb

Sign In for Pricing
View Details
MRAP (NM_206898) Human Recombinant Protein
TP318683L 1 mg

MRAP (NM_206898) Human Recombinant Protein

Sign In for Pricing
View Details
STAT3 pSer727 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 23G5]
AM00149PU-N 100 µg

STAT3 pSer727 (incl. pos. control) Mouse Monoclonal Antibody [Clone ID: 23G5]

Sign In for Pricing
View Details