Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFD0110w Protein

This PFD0110w Protein spans the amino acid sequence from region 24-269aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P86148

Expression Region

24-269aa

Tag

Tag-Free

Source

E.coli

Origin

Plasmodium falciparum (isolate 3D7)

Field of Research

Developmental Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QESYSSNEKIRKDYSDDNNYEPTPSYEKRKKEYGKDESYIKNYRGNNFSYDLSKNSSIFLHMGNGSNSKTLKRCNKKKNIKTNFLRPIEEEKTVLNNYVYKGVNFLDTIKRNDSSYKFDVYKDTSFLKNREYKELITMQYDYAYLEATKEVLYLIPKDKDYHKFYKNELEKILFNLKDSLKLLREGYIQSKLEMIRIHSDIDILNEFHQGNIINDNYFNNEIKKKKEDMEKYIREYNLYIYKYENQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr549 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4196205 3x 1.0 µg

Olfr549 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Human CNTF (E.coli-expressed)
OM770105-01 5 μg

Recombinant Human CNTF (E.coli-expressed)

Sign In for Pricing
View Details
Recombinant Human CNTF (E.coli-expressed)
OM770105-02 20 μg

Recombinant Human CNTF (E.coli-expressed)

Sign In for Pricing
View Details
Recombinant Human CNTF (E.coli-expressed)
OM770105-03 50 μg

Recombinant Human CNTF (E.coli-expressed)

Sign In for Pricing
View Details
Recombinant Human CNTF (E.coli-expressed)
OM770105-04 100 μg

Recombinant Human CNTF (E.coli-expressed)

Sign In for Pricing
View Details
Recombinant Human CNTF (E.coli-expressed)
OM770105-05 250 μg

Recombinant Human CNTF (E.coli-expressed)

Sign In for Pricing
View Details