Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human adenovirus C serotype 5 Fiber Protein

This Human adenovirus C serotype 5 Fiber Protein spans the amino acid sequence from region 1-392aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(SPIKE) (Protein IV)

UniProt

P11818

Expression Region

1-392aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human adenovirus C serotype 5 (HAdV-5) (Human adenovirus 5)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKRARPSEDTFNPVYPYDTETGPPTVPFLTPPFVSPNGFQESPPGVLSLRLSEPLVTSNGMLALKMGNGLSLDEAGNLTSQNVTTVSPPLKKTKSNINLEISAPLTVTSEALTVAAAAPLMVAGNTLTMQSQAPLTVHDSKLSIATQGPLTVSEGKLALQTSGPLTTTDSSTLTITASPPLTTATGSLGIDLKEPIYTQNGKLGLKYGAPLHVTDDLNTLTVATGPGVTINNTSLQTKVTGALGFDSQGNMQLNVAGGLRIDSQNRRLILDVSYPFDAQNQLNLRLGQGPLFINSAHNLDINYNKGLYLFTASNNSKKLEVNLSTAKGLMFDATAIAINAGDGLEFGSPNAPNTNPLKTKIGHGLEFDSNKAMVPKLGTGLSFDSTGAITVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium bovis DNA repair protein recN (recN), partial
MBS1098639 Inquire

Recombinant Mycobacterium bovis DNA repair protein recN (recN), partial

Sign In for Pricing
View Details
PM2PB rabbit pAb
RA28892-01 50 µL

PM2PB rabbit pAb

Sign In for Pricing
View Details
PM2PB rabbit pAb
RA28892-02 100 µL

PM2PB rabbit pAb

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae NADH-quinone oxidoreductase subunit K (nuoK), partial
MBS7092423 Inquire

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae NADH-quinone oxidoreductase subunit K (nuoK), partial

Sign In for Pricing
View Details
C17orf42 Polyclonal Antibody, Cy5.5 Conjugated
bs-9639R-Cy5.5 100 µL

C17orf42 Polyclonal Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
BTN2A1 Knockout jurkat Polyclonal Cells
ARG34037 1 Million

BTN2A1 Knockout jurkat Polyclonal Cells

Sign In for Pricing
View Details