Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cry1Bb Protein

This cry1Bb Protein spans the amino acid sequence from region 1111-1229aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(140 kDa crystal protein) (Crystaline entomocidal protoxin) (Insecticidal delta-endotoxin CryIB (b) )

UniProt

Q45739

Expression Region

1111-1229aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Bacillus thuringiensis

Field of Research

Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NCEEEEVYPTDTGTCNDYTAHQGTAACNSRNAGYEDAYEVDTTASVNYKPTYEEETYTDVRRDNHCEYDRGYVNYPPVPAGYVTKELEYFPETDTVWIEIGETEGKFIVDSVELLLMEE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CH-PIATA
TRC-C394580-50MG 50 mg

CH-PIATA

Sign In for Pricing
View Details
TAS2R3 (NM_016943) Human Over-expression Lysate
LH10223V 100 µg

TAS2R3 (NM_016943) Human Over-expression Lysate

Sign In for Pricing
View Details
PC-PLD3 Polyclonal Antibody
MBS8524602-01 0.1 mg

PC-PLD3 Polyclonal Antibody

Sign In for Pricing
View Details
PC-PLD3 Polyclonal Antibody
MBS8524602-02 0.1 mL (AF635)

PC-PLD3 Polyclonal Antibody

Sign In for Pricing
View Details
PC-PLD3 Polyclonal Antibody
MBS8524602-03 0.1 mL (AF610)

PC-PLD3 Polyclonal Antibody

Sign In for Pricing
View Details
PC-PLD3 Polyclonal Antibody
MBS8524602-04 0.1 mL (AF405S)

PC-PLD3 Polyclonal Antibody

Sign In for Pricing
View Details