Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Slc2a1 Protein

This Rat Slc2a1 Protein spans the amino acid sequence from region 207-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glucose transporter type 1, erythrocyte/brain) (GLUT-1)

UniProt

P11167

Expression Region

207-271aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRP2 Rabbit Polyclonal Antibody (PE)
orb496062 100 µL

LRP2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
ADAMTSL2 discontinued
385407 200 µL

ADAMTSL2 discontinued

Sign In for Pricing
View Details
GML (Glycosyl-phosphatidylinositol-anchored Molecule-like Protein, LY6DL) (FITC)
127398-FITC 100 µL

GML (Glycosyl-phosphatidylinositol-anchored Molecule-like Protein, LY6DL) (FITC)

Sign In for Pricing
View Details
Bovine Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit
MBS7263427-01 48 Well

Bovine Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit

Sign In for Pricing
View Details
Bovine Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit
MBS7263427-02 96 Well

Bovine Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit

Sign In for Pricing
View Details
Bovine Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit
MBS7263427-03 5x 96 Well

Bovine Abelson Helper Integration Site 1 Protein Homolog (AHI 1) ELISA Kit

Sign In for Pricing
View Details