Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Slc2a1 Protein

This Rat Slc2a1 Protein spans the amino acid sequence from region 207-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glucose transporter type 1, erythrocyte/brain) (GLUT-1)

UniProt

P11167

Expression Region

207-271aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ZFP106 Rabbit pAb
GB112395-100 100 μL

Anti-ZFP106 Rabbit pAb

Sign In for Pricing
View Details
Anti-CD11b/ITGAM Antibody Picoband®
A00144-1 100 µg/Vial

Anti-CD11b/ITGAM Antibody Picoband®

Sign In for Pricing
View Details
RIPK2 (Receptor Interacting Serine Threonine Kinase 2, CCK, RICK, RIP2, CARD3, GIG30, CARDIAK) discontinued
213111-01 20 µL

RIPK2 (Receptor Interacting Serine Threonine Kinase 2, CCK, RICK, RIP2, CARD3, GIG30, CARDIAK) discontinued

Sign In for Pricing
View Details
RIPK2 (Receptor Interacting Serine Threonine Kinase 2, CCK, RICK, RIP2, CARD3, GIG30, CARDIAK) discontinued
213111-02 100 µL

RIPK2 (Receptor Interacting Serine Threonine Kinase 2, CCK, RICK, RIP2, CARD3, GIG30, CARDIAK) discontinued

Sign In for Pricing
View Details
Caspase 3 (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 405)
MBS6259114-01 0.1 mL

Caspase 3 (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 405)

Sign In for Pricing
View Details
Caspase 3 (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 405)
MBS6259114-02 5x 0.1 mL

Caspase 3 (CPP-32, Apoptain, Yama, SCA-1) (MaxLight 405)

Sign In for Pricing
View Details