Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Slc2a1 Protein

This Rat Slc2a1 Protein spans the amino acid sequence from region 207-271aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Glucose transporter type 1, erythrocyte/brain) (GLUT-1)

UniProt

P11167

Expression Region

207-271aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CPESPRFLLINRNEENRAKSVLKKLRGTADVTRDLQEMKEEGRQMMREKKVTILELFRSPAYRQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsa-miR-4524a-5p miRNA Mimic
orb1877402-01 5 nmol

Hsa-miR-4524a-5p miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-4524a-5p miRNA Mimic
orb1877402-02 10 nmol

Hsa-miR-4524a-5p miRNA Mimic

Sign In for Pricing
View Details
UBE2S, CT (UBE2S, E2EPF, Ubiquitin-conjugating enzyme E2 S, E2-EPF, Ubiquitin carrier protein S, Ubiquitin-conjugating enzyme E2-24kD, Ubiquitin-conjugating enzyme E2-EPF5, Ubiquitin-protein ligase S) (MaxLight 650) discontinued
043533-ML650 100 µL

UBE2S, CT (UBE2S, E2EPF, Ubiquitin-conjugating enzyme E2 S, E2-EPF, Ubiquitin carrier protein S, Ubiquitin-conjugating enzyme E2-24kD, Ubiquitin-conjugating enzyme E2-EPF5, Ubiquitin-protein ligase S) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Vmn2r91 Protein Vector (Mouse) (pPM-C-HA)
PV246428 500 ng

Vmn2r91 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
MRP1 (ABCC1) Human Over-expression Lysate
orb1346298 100 µg

MRP1 (ABCC1) Human Over-expression Lysate

Sign In for Pricing
View Details
Influenza B (Type B Virus, Flu B)
227029 1 mg

Influenza B (Type B Virus, Flu B)

Sign In for Pricing
View Details