Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Vtg1 Protein

This vtg1 Protein spans the amino acid sequence from region 1465-1595aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(VTG)

UniProt

Q92093

Expression Region

1465-1595aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Oncorhynchus mykiss (Rainbow trout) (Salmo gairdneri)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

30.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VNEMEISNDNLPYKDPSGSIKIDRKGKGVSLYAPSHGLQEVYFDKYSWKIKVVDWMKGQTCGLCGKADGENRQEYRTPSGRLTKSSVSFAHSWVLPSDSCRDASECLMKLESVKLEKQVIVDDRESKCYSV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEYL Protein Lysate (Rat) with C-HA Tag
23229036 100 µg

HEYL Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
PERK Rabbit mAb
E60M0321 100 µL

PERK Rabbit mAb

Sign In for Pricing
View Details
(6-bromo-2-fluoro-3- (methylthio) phenyl) (ethyl) sulfane
PC1019917-01 250 mg

(6-bromo-2-fluoro-3- (methylthio) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
(6-bromo-2-fluoro-3- (methylthio) phenyl) (ethyl) sulfane
PC1019917-02 500 mg

(6-bromo-2-fluoro-3- (methylthio) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
(6-bromo-2-fluoro-3- (methylthio) phenyl) (ethyl) sulfane
PC1019917-03 1 g

(6-bromo-2-fluoro-3- (methylthio) phenyl) (ethyl) sulfane

Sign In for Pricing
View Details
SYNJ1 Polyclonal Antibody
orb617275-01 50 μL

SYNJ1 Polyclonal Antibody

Sign In for Pricing
View Details