Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPA1 Protein

This Human PPA1 Protein spans the amino acid sequence from region 228-289aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Pyrophosphate phospho-hydrolase) (PPase)

UniProt

Q15181

Expression Region

228-289aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGEA2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1253408 1.0 µg DNA

MAGEA2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Gtf2h2 Mouse shRNA Plasmid (Locus ID 23894)
TL502511 1 Kit

Gtf2h2 Mouse shRNA Plasmid (Locus ID 23894)

Sign In for Pricing
View Details
Recombinant Chicken Spastin (SPAST)
MBS7030250-01 0.02 mg

Recombinant Chicken Spastin (SPAST)

Sign In for Pricing
View Details
Recombinant Chicken Spastin (SPAST)
MBS7030250-02 0.1 mg

Recombinant Chicken Spastin (SPAST)

Sign In for Pricing
View Details
Recombinant Chicken Spastin (SPAST)
MBS7030250-03 5x 0.1 mg

Recombinant Chicken Spastin (SPAST)

Sign In for Pricing
View Details
ELISA Kit for Acidic Salivary Proline Rich Phosphoprotein 2 (PRH2)
TRV-0040914-01 24 Tests

ELISA Kit for Acidic Salivary Proline Rich Phosphoprotein 2 (PRH2)

Sign In for Pricing
View Details