Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPA1 Protein

This Human PPA1 Protein spans the amino acid sequence from region 228-289aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Pyrophosphate phospho-hydrolase) (PPase)

UniProt

Q15181

Expression Region

228-289aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDVDKWFHHQKN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD26-set siRNA/shRNA/RNAi Lentivector (Human)
44851091 4x 500 ng

SNORD26-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Diversey Suma Select Pur-Eco Concentrated Neutral Rinse Additive A7 5L - PK2
SAF5386 2 / PCK

Diversey Suma Select Pur-Eco Concentrated Neutral Rinse Additive A7 5L - PK2

Sign In for Pricing
View Details
Recombinant Mouse GDF-8/Myostatin/Mstn Protein, His Tag
MOP2166 50 µg

Recombinant Mouse GDF-8/Myostatin/Mstn Protein, His Tag

Sign In for Pricing
View Details
Thnsl2 Mouse shRNA Plasmid (Locus ID 232078)
TR510546 1 Kit

Thnsl2 Mouse shRNA Plasmid (Locus ID 232078)

Sign In for Pricing
View Details
Angpt2 Polyclonal Antibody
A52516-020 20 µL

Angpt2 Polyclonal Antibody

Sign In for Pricing
View Details
CABLES1 Protein Vector (Mouse) (pPB-N-His)
PV160671 500 ng

CABLES1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details