Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OmpK36 Protein

This OmpK36 Protein spans the amino acid sequence from region 22-372aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Outer membrane protein C) (Phosphoporin PhoE) (Porin OmpK36)

UniProt

D6QLY3

Expression Region

22-372aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Klebsiella pneumoniae

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGTSPTNNGRGALKQNGDGFGTSLTYDIYDGISAGFAYSHSKRNGDQNRLDKGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRFSGNGESDSISGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDIEGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDENDFTRRAGISTDDVVALGLVYQF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL28 Antibody, HRP conjugated
CSB-PA020217EB01HU-01 50 µg

RPL28 Antibody, HRP conjugated

Sign In for Pricing
View Details
RPL28 Antibody, HRP conjugated
CSB-PA020217EB01HU-02 100 µg

RPL28 Antibody, HRP conjugated

Sign In for Pricing
View Details
Compound NP-007016
MBS5795424 Inquire

Compound NP-007016

Sign In for Pricing
View Details
ZPR1 discontinued
396345 200 µL

ZPR1 discontinued

Sign In for Pricing
View Details
8- Bromo- 2', 3'- O- (2, 4, 6- trinitrophenyl) guanosine- 5'- O- triphosphate (8-Br-TNP-GTP), sodium salt
B 153-05 5x 1 µmol

8- Bromo- 2', 3'- O- (2, 4, 6- trinitrophenyl) guanosine- 5'- O- triphosphate (8-Br-TNP-GTP), sodium salt

Sign In for Pricing
View Details
Recombinant Actinobacillus pleuropneumoniae serotype 3 Glutamine amidotransferase subunit pdxT (pdxT)
MBS1092792-01 0.02 mg (E-Coli)

Recombinant Actinobacillus pleuropneumoniae serotype 3 Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details