Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OmpK36 Protein

This OmpK36 Protein spans the amino acid sequence from region 22-372aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Outer membrane protein C) (Phosphoporin PhoE) (Porin OmpK36)

UniProt

D6QLY3

Expression Region

22-372aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Klebsiella pneumoniae

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGTSPTNNGRGALKQNGDGFGTSLTYDIYDGISAGFAYSHSKRNGDQNRLDKGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRFSGNGESDSISGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDIEGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDENDFTRRAGISTDDVVALGLVYQF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CAVIN1 Protein, N-His-SUMO & C-Strep
HP645012-01 50 µg

Recombinant Human CAVIN1 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human CAVIN1 Protein, N-His-SUMO & C-Strep
HP645012-02 100 µg

Recombinant Human CAVIN1 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Recombinant Human CAVIN1 Protein, N-His-SUMO & C-Strep
HP645012-03 1 mg

Recombinant Human CAVIN1 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Torsin A Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61130R-BF488-01 20 µL

Torsin A Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Torsin A Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61130R-BF488-02 100 µL

Torsin A Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Dnajc21 3'UTR Lenti-reporter-Luc Vector
18402086 1.0 µg

Dnajc21 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details