Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OmpK36 Protein

This OmpK36 Protein spans the amino acid sequence from region 22-372aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Outer membrane protein C) (Phosphoporin PhoE) (Porin OmpK36)

UniProt

D6QLY3

Expression Region

22-372aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Klebsiella pneumoniae

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AEIYNKDGNKLDLYGKIDGLHYFSDDKSVDGDQTYMRVGVKGETQINDQLTGYGQWEYNVQANNTESSSDQAWTRLAFAGLKFGDAGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFLQSRANGVATYRNSDFFGLVDGLNFALQYQGKNGSVSGEGTSPTNNGRGALKQNGDGFGTSLTYDIYDGISAGFAYSHSKRNGDQNRLDKGRGDNAETYTGGLKYDANNIYLATQYTQTYNATRFSGNGESDSISGFANKAQNFEVVAQYQFDFGLRPSVAYLQSKGKDIEGYGDQDLLKYVDVGATYYFNKNMSTYVDYKINLLDENDFTRRAGISTDDVVALGLVYQF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HHAT Recombinant Protein (Human)
RP039763 100 µg

HHAT Recombinant Protein (Human)

Sign In for Pricing
View Details
ATG7, CT (ATG7, APG7L, Ubiquitin-like modifier-activating enzyme ATG7, ATG12-activating enzyme E1 ATG7, Autophagy-related protein 7, Ubiquitin-activating enzyme E1-like protein) (MaxLight 490)
MBS6276233-01 0.1 mL

ATG7, CT (ATG7, APG7L, Ubiquitin-like modifier-activating enzyme ATG7, ATG12-activating enzyme E1 ATG7, Autophagy-related protein 7, Ubiquitin-activating enzyme E1-like protein) (MaxLight 490)

Sign In for Pricing
View Details
ATG7, CT (ATG7, APG7L, Ubiquitin-like modifier-activating enzyme ATG7, ATG12-activating enzyme E1 ATG7, Autophagy-related protein 7, Ubiquitin-activating enzyme E1-like protein) (MaxLight 490)
MBS6276233-02 5x 0.1 mL

ATG7, CT (ATG7, APG7L, Ubiquitin-like modifier-activating enzyme ATG7, ATG12-activating enzyme E1 ATG7, Autophagy-related protein 7, Ubiquitin-activating enzyme E1-like protein) (MaxLight 490)

Sign In for Pricing
View Details
Cpne3 AAV siRNA Pooled Vector
16761166 1.0 µg

Cpne3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Human ABCC6 knockdown cell line
ABC-KD0056 1 Vial

Human ABCC6 knockdown cell line

Sign In for Pricing
View Details
Tada2b 3'UTR GFP Stable Cell Line
TU170091 1.0 mL

Tada2b 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details