Mouse Ccl21c Protein
This Mouse Ccl21c Protein spans the amino acid sequence from region 24-133aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(6Ckine) (Beta-chemokine exodus-2) (Small-inducible cytokine A21c) (Thymus-derived chemotactic agent 4) (TCA4)
UniProt
P86793
Expression Region
24-133aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Epigenetics, Immunology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![4- (2-Aminoethyl) -5-[2- (methylthio) phenyl]-1,2-dihydro-3h-pyrazol-3-one](https://cdn.genprice.uk/genprice/uk/genprice3.webp)
428512-01 100 mg
4- (2-Aminoethyl) -5-[2- (methylthio) phenyl]-1,2-dihydro-3h-pyrazol-3-one
Sign In for Pricing
View Details 428512-02 250 mg
4- (2-Aminoethyl) -5-[2- (methylthio) phenyl]-1,2-dihydro-3h-pyrazol-3-one
Sign In for Pricing
View Details GTR15292337 1 Vial
Lentiviral mouse Cyba shRNA (UAS) - Lentiviral mouse Cyba shRNA (UAS) (25)
Sign In for Pricing
View Details orb2367724 100 µL
P53 (Acetyl K382) Mouse Monoclonal Antibody (APC-Cy5.5)
Sign In for Pricing
View Details