Mouse Ccl21c Protein
This Mouse Ccl21c Protein spans the amino acid sequence from region 24-133aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
(6Ckine) (Beta-chemokine exodus-2) (Small-inducible cytokine A21c) (Thymus-derived chemotactic agent 4) (TCA4)
UniProt
P86793
Expression Region
24-133aa
Tag
N-terminal 6xHis-SUMO-tagged
Source
E.coli
Origin
Mus musculus (Mouse)
Field of Research
Epigenetics, Immunology
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
25.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SDGGGQDCCLKYSQKKIPYSIVRGYRKQEPSLGCPIPAILFLPRKHSKPELCANPEEGWVQNLMRRLDQPPAPGKQSPGCRKNRGTSKSGKKGKGSKGCKRTEQTQPSRG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
SED1070S 1 Each
Double Adj Trolley 725mm Set 01 Grey with Cyan Trays
Sign In for Pricing
View Details 
217344-HRP 100 µL
ErbB2 (Receptor Tyrosine-protein Kinase erbB-2, Metastatic Lymph Node Gene 19 Protein, MLN 19, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, Tyrosine Kinase-type Cell Surface Receptor HER2, CD340, p185erbB2, HER2, MLN19, NEU, NGL) (HRP)
Sign In for Pricing
View Details orb776325-01 48 Tests
Human Alanine Aminotransferase (ALT) ELISA Kit
Sign In for Pricing
View Details orb776325-02 96 Tests
Human Alanine Aminotransferase (ALT) ELISA Kit
Sign In for Pricing
View Details