Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabies virus Matrix Protein

This Rabies virus Matrix Protein spans the amino acid sequence from region 1-202aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Phosphoprotein M2)

UniProt

P15200

Expression Region

1-202aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Rabies virus (strain PM1503/AVO1) (RABV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNVLRKIVKKCRDEDTQKPSPVSAPPDDDDLWLPPPEYVPLKELTSKKNMRNFCVNGDVKACSPNGYSFRILRHILRSFNEIYSGNHRMIGLVKVVVGLALSGAPVPEGMNWVYKLRRTLIFQWADSRGPLEGEELEYSQEITWDDDTEFVGLQIRVSARQCHIQGRIWCINTNSRACQLWSDMSLQTQRSEEDKDSSLLLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EnzyFluo™ L-Lactate Assay Kit
EFLLC-100 100 Tests

EnzyFluo™ L-Lactate Assay Kit

Sign In for Pricing
View Details
TBC1D25 (NM_002536) Human Over-expression Lysate
LY419247 100 µg

TBC1D25 (NM_002536) Human Over-expression Lysate

Sign In for Pricing
View Details
SNAIL (SNAI1) (NM_005985) Human Over-expression Lysate
LY401811 100 µg

SNAIL (SNAI1) (NM_005985) Human Over-expression Lysate

Sign In for Pricing
View Details
Benchtop High Speed Centrifuge BCBH-202
BCBH-202 1 Unit

Benchtop High Speed Centrifuge BCBH-202

Sign In for Pricing
View Details
Recombinant Mouse Siglec-10 (C-Fc)
PKSM041425-01 10 µg

Recombinant Mouse Siglec-10 (C-Fc)

Sign In for Pricing
View Details
Recombinant Mouse Siglec-10 (C-Fc)
PKSM041425-02 50 µg

Recombinant Mouse Siglec-10 (C-Fc)

Sign In for Pricing
View Details