Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NR2F1 Protein

This Human NR2F1 Protein spans the amino acid sequence from region 1-423aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(COUP-TF1) (COUP transcription factor I) (COUP-TF I) (Nuclear receptor subfamily 2 group F member 1) (V-erbA-related protein 3) (EAR-3)

UniProt

P10589

Expression Region

1-423aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQFTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVGMRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPTSRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVSLLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIRIFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQCALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIETLIRDMLLSGSSFNWPYMSIQCS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C030018G13Rik Mouse siRNA Oligo Duplex (Locus ID 241076)
SR408640 1 Kit

C030018G13Rik Mouse siRNA Oligo Duplex (Locus ID 241076)

Sign In for Pricing
View Details
MYOM2 Protein Lysate (Mouse) with C-HA Tag
31311034 100 µg

MYOM2 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Anti-E-Cadherin Antibody, Rabbit Polyclonal
MBS8111898-01 0.1 mL

Anti-E-Cadherin Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-E-Cadherin Antibody, Rabbit Polyclonal
MBS8111898-02 5x 0.1 mL

Anti-E-Cadherin Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
HELLS (Helicase Lymphoid-Specific, FLJ10339, Lymphoid Specific Helicase, LSH, Nbla10143, PASG, Proliferation-associated SNF2-like Protein, SWI/SNF2-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 6, SMARCA6) (Biotin)
127792-Biotin 100 µL

HELLS (Helicase Lymphoid-Specific, FLJ10339, Lymphoid Specific Helicase, LSH, Nbla10143, PASG, Proliferation-associated SNF2-like Protein, SWI/SNF2-related Matrix-associated Actin-dependent Regulator of Chromatin Subfamily A Member 6, SMARCA6) (Biotin)

Sign In for Pricing
View Details
TFF2 Antibody
A36449-100UL 100 µL

TFF2 Antibody

Sign In for Pricing
View Details