Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine coronavirus Non-structural protein of 4.9 kDa Protein

This Bovine coronavirus Non-structural protein of 4.9 kDa Protein spans the amino acid sequence from region 1-44aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(ns4.9) (4.9 kDa accessory protein)

UniProt

Q9QAS1

Expression Region

1-44aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bovine coronavirus (strain LY-138) (BCoV) (BCV)

Field of Research

Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MTTKFVFDLLAPDDILHPFNHVKLIIIRPIEVEHIIIATTMPAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ska3 CRISPR Activation Plasmid (h2)
sc-405767-ACT-2 20 µg

Ska3 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
HSPA12A Lentiviral Activation Particles (m)
sc-428569-LAC 200 µL

HSPA12A Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Human MYH14 siRNA
abx925142-01 15 nmol

Human MYH14 siRNA

Sign In for Pricing
View Details
Human MYH14 siRNA
abx925142-02 30 nmol

Human MYH14 siRNA

Sign In for Pricing
View Details
RND2 (NM_005440) Human Mass Spec Standard
PH321840 10 µg

RND2 (NM_005440) Human Mass Spec Standard

Sign In for Pricing
View Details
Exoc7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6978508 1.0 µg DNA

Exoc7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details