Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CORIN Protein

This Human CORIN Protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(Corin) (Heart-specific serine proteinase ATC2) (Pro-ANP-converting enzyme) (Transmembrane protease serine 10)

UniProt

Q9Y5Q5

Expression Region

1-110aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDFY1 Antibody, Biotin conjugated
CSB-PA816890LD01HU-01 50 µg

WDFY1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
WDFY1 Antibody, Biotin conjugated
CSB-PA816890LD01HU-02 100 µg

WDFY1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral mouse Rbpj shRNA (UAS) - Lentiviral mouse Rbpj shRNA (UAS, GFP) (100)
GTR15234465 1 Vial

Lentiviral mouse Rbpj shRNA (UAS) - Lentiviral mouse Rbpj shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
PIM1 Polyclonal Antibody
BS65634-01 50 µL

PIM1 Polyclonal Antibody

Sign In for Pricing
View Details
PIM1 Polyclonal Antibody
BS65634-02 100 µL

PIM1 Polyclonal Antibody

Sign In for Pricing
View Details
TROVE2 Antibody (FITC)
orb239101-01 50 µg

TROVE2 Antibody (FITC)

Sign In for Pricing
View Details