Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COL6A2 Protein

This Human COL6A2 Protein spans the amino acid sequence from region 254-400aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P12110

Expression Region

254-400aa

Tag

N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IPGPSGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGNRGPDGYPGEAGSPGERGDQGGKGDPGRPGRRGPPGEIGAKGSKGYQGNSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psme1 Mouse Pre-designed siRNA Set A
HY-RS20088 1 Set

Psme1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
Lentiviral mouse Fuom shRNA (UAS) - Lentiviral mouse Fuom shRNA (UAS) (25)
GTR15211985 1 Vial

Lentiviral mouse Fuom shRNA (UAS) - Lentiviral mouse Fuom shRNA (UAS) (25)

Sign In for Pricing
View Details
PLV3-CMV-Itga5-3xFLAG-mCherry-Puro Plasmid
PVT77032 2 µg

PLV3-CMV-Itga5-3xFLAG-mCherry-Puro Plasmid

Sign In for Pricing
View Details
2-Acetyl-3-thienylboronic acid
414841-01 100 mg

2-Acetyl-3-thienylboronic acid

Sign In for Pricing
View Details
2-Acetyl-3-thienylboronic acid
414841-02 250 mg

2-Acetyl-3-thienylboronic acid

Sign In for Pricing
View Details
POLR3F Rabbit Polyclonal Antibody (Cy3)
orb2582227 100 µg

POLR3F Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details